PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00092876001
Common NameGSBRNA2T00092876001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 353aa    MW: 39166.7 Da    PI: 5.5242
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00092876001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32155209155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fv+a++qLGGse+AtPk++l+l++ +gLt++hvkSHLQkYR+
  GSBRNA2T00092876001 155 KQRMRWTPELHEAFVDAINQLGGSERATPKAVLKLINSPGLTIYHVKSHLQKYRT 209
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.862152212IPR017930Myb domain
SuperFamilySSF466896.81E-17153209IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-30154211IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-23155209IPR006447Myb domain, plants
PfamPF002494.5E-10157208IPR001005SANT/Myb domain
PfamPF143791.9E-22243289IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MNNPVPCQVF PLASGGTSSG YCNGTYVSAQ ERSSSQTRQS VETQSLPVTN QPQEQRDMSW  60
PEDQLQGFFD FPPQGESSSR AKSEWPDWAN QMISVDDGLE PNWSEILGDP NVLNQDSKIP  120
APSRDVARQE IVVSTQNQVD PSSAKSPQAS SMTSKQRMRW TPELHEAFVD AINQLGGSER  180
ATPKAVLKLI NSPGLTIYHV KSHLQKYRTA RYKPEISIDT EKPPLKTLKT IEDIKSLDLK  240
TSIEITEALR LQMEVQKKLH EQLEVQRTLQ LQIEEQGRYL QMMIEKQQQK MQEKKIGSSS  300
GTSSMPEADT SSAPSPNLSQ ASVTERLQSG GSSTLDQSGY PSGATKKRVR ED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00092876001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009123994.10.0PREDICTED: protein PHR1-LIKE 1 isoform X2
RefseqXP_009123993.10.0PREDICTED: protein PHR1-LIKE 1 isoform X2
RefseqXP_009123992.10.0PREDICTED: protein PHR1-LIKE 1 isoform X2
SwissprotQ8GUN51e-115PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078IIW80.0A0A078IIW8_BRANA; BnaA05g33010D protein
STRINGBra040196.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.21e-162G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]